DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss29

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:230 Identity:76/230 - (33%)
Similarity:116/230 - (50%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKK 234
            :.||||:|..::|||||||....:|.|.  .:|:|:..|...|     :||.:.:|..||::...
Mouse    60 HNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGK-----ELLSVSRVIIHPDFVHA 119

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRLWVFP--ELPTT---IAFAMGYGATSFAK--PMTNRLTNL 292
            ....|:|||:|...|:....|:||:|   |  .|..|   :.:..|:||.|..:  |...||..:
Mouse   120 GLGSDVALLQLAVSVQSFPNVKPVKL---PSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQV 181

  Fly   293 NLTVVPNAECNAELPPLAETPSG-----VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH 352
            .:.::.|:.|. |:...|.....     :|:..:||.:.  .:|:|.|||||||..|:.|     
Mouse   182 QVKIIDNSLCE-EMYHNATRHRNRGQKLILKDMLCAGNQ--GQDSCYGDSGGPLVCNVTG----- 238

  Fly   353 RIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWI 386
              .:.|:|:.|:|..|. ..:|.||.||.|||.||
Mouse   239 --SWTLVGVVSWGYGCALRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/230 (33%)
Tryp_SPc 146..386 CDD:214473 74/228 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 76/230 (33%)
Tryp_SPc 31..271 CDD:214473 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.