DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and f7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:320 Identity:89/320 - (27%)
Similarity:136/320 - (42%) Gaps:76/320 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ENKQRRLCEQKYSEYVE---------RIFP------NDTAVAADANDADFDGRVLARPGEYPHMA 159
            |...||.|......|::         .:||      .....||| :..|...|::.         
Zfish   144 EQDGRRNCSCADGYYLDNGGQKCRSHEVFPCGKVPLLQAGKAAD-HQVDLRSRIVG--------- 198

  Fly   160 AVGFESDRGQVDYK----------CGGSLISERFVLTAAHCTSIYEAPPKWVRI--GDLDLASEK 212
              |.|..:|...::          |||.:....::||||||  :.:...|::||  |:.||..::
Zfish   199 --GSECPKGHCPWQVLLKYGEKGFCGGVIYKPTWILTAAHC--LEKLKVKFLRIVAGEHDLEVDE 259

  Fly   213 RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV----------RLWVFPELP 267
            .:  .||::::|:|.||.|..:....|||||:|...:..:.|..||          .||...:  
Zfish   260 GT--EQLIQVDQMFTHPAYVSETADSDIALLRLRTPIVYSVYAVPVCLPLREMAERELWAVSK-- 320

  Fly   268 TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNR-D 331
            .|::   |:|..|...|.:..|..|.:..:...||       .:..:..|.|.:....||..| |
Zfish   321 HTVS---GWGKRSEDGPTSRLLRRLLVPRIRTQEC-------VQVSNLTLTSNMFCAGYIEGRQD 375

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR--SSYPSVYTRVSSFLDWIELT 389
            :|:|||||||...       :|....|:||.|:|..|.  .|| .:|||||::|.||..|
Zfish   376 SCKGDSGGPLVTR-------YRDTAFLLGIVSWGKGCARPGSY-GIYTRVSNYLQWIRQT 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/265 (29%)
Tryp_SPc 146..386 CDD:214473 75/264 (28%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342 5/21 (24%)
Tryp_SPc 195..424 CDD:214473 75/263 (29%)
Tryp_SPc 196..427 CDD:238113 76/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.