DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Acr

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_038483.1 Gene:Acr / 11434 MGIID:87884 Length:436 Species:Mus musculus


Alignment Length:262 Identity:79/262 - (30%)
Similarity:123/262 - (46%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVG-FESDRGQVDYKCGGSLISERFVLTAAHC----TSIYEAPPKWVRI---GDL 206
            |:.|.:|.|.::. |.|...:..:.|||||::..:|||||||    ..:|:    |..:   .::
Mouse    49 AQLGAWPWMVSLQIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYD----WRLVFGAQEI 109

  Fly   207 DLASEKRSVEAQLLR-IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVF----PEL 266
            :....|...|.|..| ::::..|..|......:||||||:...|....::.|..|..|    |::
Mouse   110 EYGRNKPVKEPQQERYVQKIVIHEKYNVVTEGNDIALLKITPPVTCGNFIGPCCLPHFKAGPPQI 174

  Fly   267 PTTIAFAMGYGATSFAKP------MTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQICAQ 324
            |.| .:..|:|......|      |..|:..::|.:     ||:     .:..:| |..:.:||.
Mouse   175 PHT-CYVTGWGYIKEKAPRPSPVLMEARVDLIDLDL-----CNS-----TQWYNGRVTSTNVCAG 228

  Fly   325 DYILNRDTCQGDSGGPL----QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLD 384
            ......|||||||||||    .::.|         :.::||||:||.| |:..|.|||....:||
Mouse   229 YPEGKIDTCQGDSGGPLMCRDNVDSP---------FVVVGITSWGVGCARAKRPGVYTATWDYLD 284

  Fly   385 WI 386
            ||
Mouse   285 WI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/262 (30%)
Tryp_SPc 146..386 CDD:214473 77/260 (30%)
AcrNP_038483.1 Tryp_SPc 42..286 CDD:214473 77/260 (30%)
Tryp_SPc 43..289 CDD:238113 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.