DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP013089

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_003436251.1 Gene:AgaP_AGAP013089 / 11175918 VectorBaseID:AGAP013089 Length:634 Species:Anopheles gambiae


Alignment Length:258 Identity:93/258 - (36%)
Similarity:140/258 - (54%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVD----YKCGGSLISERFVLTAAHC--TSIYEAPPKWVRIG 204
            |.|.|:...:|.|||:|:.|...:::    :.|||:||:...|||.|||  |::|     :||:|
Mosquito   383 GGVDAQLNAWPWMAALGYRSTSFELNAGPRFLCGGTLITTLHVLTVAHCIQTALY-----FVRLG 442

  Fly   205 DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWV-----FP 264
            :||:.|::.......:.|::...|..|.:|..|:||||:.|:|.|.:||.|||:.|.|     ..
Mosquito   443 ELDITSDQDGANPVDIYIQRWVVHERYDEKKIYNDIALVLLQKSVTITEAVRPICLPVEAKQRTK 507

  Fly   265 ELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAEC--NAELPPLAETPSGVLESQI-CAQDY 326
            :|.....|..|:||..:..|...||....:.|:|..:|  |.:|    ..|..:.:..: ||...
Mosquito   508 DLTYYAPFIAGWGAVGYNGPTAARLQEAQVVVLPVDQCAFNYKL----YFPGQIFDDTVLCAGFP 568

  Fly   327 ILNRDTCQGDSGGPLQLNLPG-RRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            ...:|:|||||||||.  ||. ...|...:|.|||:.|||..| |:.:|.||.:|:::|.|||
Mosquito   569 QGGKDSCQGDSGGPLM--LPELSSNGQYYYYTLIGLISYGYECARAGFPGVYVKVTAYLPWIE 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 91/256 (36%)
Tryp_SPc 146..386 CDD:214473 90/255 (35%)
AgaP_AGAP013089XP_003436251.1 CLIP 250..304 CDD:288855
Tryp_SPc 380..628 CDD:214473 90/255 (35%)
Tryp_SPc 381..631 CDD:238113 93/258 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.