DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:298 Identity:99/298 - (33%)
Similarity:149/298 - (50%) Gaps:29/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RRLCEQKYSEYVERIFPNDTAV--AADANDADFD------------GRVLARPGEYPHMAAVGFE 164
            :||..:|..||...:....|.:  ........|:            |...|:.||:||.|.:||.
Mosquito    25 QRLATRKCLEYQNIVVNRQTLIPLTIKPKPIQFEVYNCTNVVQLIVGGEQAKYGEFPHHALLGFS 89

  Fly   165 SDRG---QVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVF 226
            .:.|   ..|::|||:|||::.:||||||.:.  ..|..||:|:.|  :|..:.:.....|..:.
Mosquito    90 KENGNQWDYDFRCGGTLISDQHILTAAHCFAY--GDPVIVRVGEYD--TELETDDEYDSDIASIR 150

  Fly   227 AHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTT--IAFAMGYGATSFAKPMTNRL 289
            .||||.....||||||:||:..:.|::::||..||...|..:|  ||...||..| :...::..:
Mosquito   151 RHPNYSNLRSYDDIALVKLKHPIVLSKHIRPACLWETEERNSTRYIATGFGYNET-YGTTLSTVM 214

  Fly   290 TNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRI 354
            ..:||...|.::|............||.:.|:|....:..|||||||||||||:....:    ..
Mosquito   215 MKVNLDEFPVSDCERNFKGDRRFKQGVRDGQLCVGSIVEGRDTCQGDSGGPLQVVTNTK----SC 275

  Fly   355 HYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIELTVW 391
            .|.::||||.|..|. .:..::||:||.::||||..||
Mosquito   276 SYGVVGITSVGGVCGIGNAKAIYTKVSHYIDWIEDNVW 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 88/246 (36%)
Tryp_SPc 146..386 CDD:214473 87/245 (36%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 90/250 (36%)
Tryp_SPc 69..308 CDD:214473 87/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BNNF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.