DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F11

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:302 Identity:89/302 - (29%)
Similarity:125/302 - (41%) Gaps:50/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ENKQRRLCEQKYSE----------------YVERIFPNDTAVAADANDADFDGRVLARPGEYPHM 158
            |..:|..|..|.|.                |..|:...|.......|.....|..... ||:|..
Mouse   341 ERNRRGRCYLKLSSNGSPTRILHGRGGISGYSLRLCKMDNVCTTKINPRVVGGAASVH-GEWPWQ 404

  Fly   159 AAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIE 223
              |.....:|.:   ||||:|..:::||||||.|..|.|.|....|.:...||.....| ..|::
Mouse   405 --VTLHISQGHL---CGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIVNQSEINEGTA-FFRVQ 463

  Fly   224 QVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT--------TIAFAMGYGATS 280
            ::..|..|.......||||||||..:..|::.||:.      ||:        |..:..|:|.|:
Mouse   464 EMIIHDQYTTAESGYDIALLKLESAMNYTDFQRPIC------LPSKGDRNAVHTECWVTGWGYTA 522

  Fly   281 FAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNL 345
            ....:.:.|....:.:|.|.||....     ....:....|||......:|||:|||||||....
Mouse   523 LRGEVQSTLQKAKVPLVSNEECQTRY-----RRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKY 582

  Fly   346 PGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            .|       .:||:||||:|..| :...|.|||.|:.::|||
Mouse   583 NG-------VWHLVGITSWGEGCGQKERPGVYTNVAKYVDWI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/250 (32%)
Tryp_SPc 146..386 CDD:214473 78/248 (31%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519 7/34 (21%)
Tryp_SPc 389..617 CDD:214473 78/252 (31%)
Tryp_SPc 390..617 CDD:238113 78/251 (31%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/7 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.