DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC108648789

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031749506.1 Gene:LOC108648789 / 108648789 -ID:- Length:289 Species:Xenopus tropicalis


Alignment Length:249 Identity:72/249 - (28%)
Similarity:117/249 - (46%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKR 213
            |.|||.||:                |||:||.|:::||||.|..........|.:||.:|.:..:
 Frog    53 LRRPGYYPY----------------CGGTLIGEKWILTAAACIHSNTKSSFQVFVGDYNLDNTDK 101

  Fly   214 SVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGA 278
            .  .|.:.::::..||:|::....|:||||:|..:|::.:...||.|   |:...|.........
 Frog   102 G--EQPVSVKRIIIHPSYREGYLNDNIALLELATKVQMNKVTLPVCL---PDASVTFPDGQKCSV 161

  Fly   279 TSFAK-------PMTNRLTNLNLTVVPNAECNA--ELP-PLAETPSGVLESQICAQDYILNRDTC 333
            |.:.:       |....|..:.:.::.|..||.  .:| ....|.:.:.::.:||......||:|
 Frog   162 TGWGQIMDGADPPSPRVLREVEVKMMSNDRCNTLFNIPDAYGRTTANLTDTMLCAGYAKGGRDSC 226

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            .||.||||.....||       ::|.|:.|.|..| :.:.|.:||||||::.||
 Frog   227 NGDVGGPLVCPKDGR-------WYLAGVVSGGDGCGKPNRPGIYTRVSSYIKWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/249 (29%)
Tryp_SPc 146..386 CDD:214473 70/247 (28%)
LOC108648789XP_031749506.1 Tryp_SPc 36..273 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.