DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:258 Identity:76/258 - (29%)
Similarity:112/258 - (43%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-----TSIYEAPPKWVRIG-----DLDLA 209
            :|..|::.:.|  ||.   ||||||::.:||:||||     ...|..    |.:|     ..|.:
Zfish   319 WPWQASLYWYS--GQT---CGGSLINKEWVLSAAHCFNGQRNGFYLT----VILGPKTQNKYDPS 374

  Fly   210 SEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL-------------W 261
            ...|||:|       |..||.|......:||||::|...:..|:.:|||.|             |
Zfish   375 RISRSVKA-------VIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESW 432

  Fly   262 VFPELPTTIAFAMGYGATSFAKPMTNR--LTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQ 324
            :     ||      :...|...|:.:.  ...:.:.|:.|.:||.     ......:.::.|||.
Zfish   433 I-----TT------WRNISDGVPLPSPKIFQEVEVPVIGNRQCNC-----LYGVGSITDNMICAG 481

  Fly   325 DYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            .....:|.||||||||:..|       ....:...||.|:|..| :|.:|.||||||.:.:||
Zfish   482 LLKEGKDLCQGDSGGPMVSN-------QSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/258 (29%)
Tryp_SPc 146..386 CDD:214473 74/256 (29%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.