DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk15

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:253 Identity:68/253 - (26%)
Similarity:90/253 - (35%) Gaps:105/253 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW 200
            ||...|...:|.... |...|...|: ||..|    :.||..|||..:|||||||.:.:..    
  Rat    13 AAQDGDKVLEGEECV-PHSQPWQVAL-FERGR----FNCGAFLISPHWVLTAAHCQTRFMR---- 67

  Fly   201 VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE 265
            ||:|:.:|  .|.....||..:.::..||.|:.:.:..||.||:|         .||.||     
  Rat    68 VRLGEHNL--RKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRL---------FRPARL----- 116

  Fly   266 LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNR 330
                                                          ||                 
  Rat   117 ----------------------------------------------TP----------------- 118

  Fly   331 DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG-VFC-RSSYPSVYTRVSSFLDWI 386
               ||||||||...  |.         |.||.|:| |.| .::.|.|||:|.|::|||
  Rat   119 ---QGDSGGPLVCG--GA---------LQGIVSWGDVPCDTTTKPGVYTKVCSYMDWI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 65/243 (27%)
Tryp_SPc 146..386 CDD:214473 63/241 (26%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.