DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:290 Identity:79/290 - (27%)
Similarity:123/290 - (42%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NDTAVAADAN-----------DADFDGRVL----ARPGEYPHMAAVGFESDRGQVD--------- 171
            |.:|..|..|           ....|.|::    |..|::|           .||:         
 Frog   237 NYSATCASGNMVSLRCISCGLSTKVDSRIVGGTPASVGDWP-----------WQVELLKLVGTSI 290

  Fly   172 YKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--GDLDLASEKRSVEAQLLRIEQVFAHPNYKKK 234
            |.||||:|:..:::|||||.....:.|...::  |.|.:    :|..:....:|:...||:|...
 Frog   291 YLCGGSIITPHWIVTAAHCVYGSTSTPSAFKVFAGSLTI----QSYYSAGYTVERALVHPSYSSY 351

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRL------WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLN 293
            ....|:|||||...:..|..:|||.|      |...: |..|:   |:|.|:....::..|...:
 Frog   352 TQIYDVALLKLTAALVFTTNLRPVCLPNVGMPWAEGQ-PCWIS---GWGTTAEGGSISKNLMAAS 412

  Fly   294 LTVVPNAECNAELPPLAETPSGVLESQICAQDYIL-NRDTCQGDSGGPLQLNLPGRRRGHRIHYH 357
            :.::.:..||.     |....|.:.|.:....|:. ..|||||||||||.......       :.
 Frog   413 VPIISSTTCNQ-----AAVYGGAISSTMMCAGYLSGGTDTCQGDSGGPLVTKTNSL-------WW 465

  Fly   358 LIGITSYGVFCRSSY-PSVYTRVSSFLDWI 386
            |:|.||:|..|..:| |.||..|:.|::||
 Frog   466 LVGDTSWGYGCARAYKPGVYGNVTVFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 74/264 (28%)
Tryp_SPc 146..386 CDD:214473 72/262 (27%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 4/21 (19%)
Tryp_SPc 265..498 CDD:238113 73/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.