DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC101732176

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:255 Identity:84/255 - (32%)
Similarity:123/255 - (48%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPH----MAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--G 204
            |...|..|::|.    |..||...      |.||||:|:..:::|||||...|.:.|...::  |
 Frog   279 GGTFALAGDWPWQISLMKLVGTSL------YLCGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAG 337

  Fly   205 DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL------WVF 263
            .|.|::   ...|..| :::|..||:|.......|||||||:..:..:..:|||.|      |..
 Frog   338 SLTLSN---YYSAGYL-VDRVLIHPSYSPNTQNYDIALLKLKTALVFSTNLRPVCLPNVGMPWAD 398

  Fly   264 PELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE-SQICAQDYI 327
            .: |..|:   |:|.||.|..::..|...::.::.:|.||     ||....||:. :.|||....
 Frog   399 GQ-PCWIS---GWGTTSEAGSISTSLKAASVPIISSATCN-----LAPVYGGVISPTMICAGYLG 454

  Fly   328 LNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY-PSVYTRVSSFLDWI 386
            ...|||||||||||.......       :.|:|.||:|..|..:| |.||..::.||:||
 Frog   455 GGTDTCQGDSGGPLVTKTNSL-------WWLVGDTSWGYGCARAYKPGVYGNITVFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 84/255 (33%)
Tryp_SPc 146..386 CDD:214473 82/253 (32%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055
Tryp_SPc 277..510 CDD:238113 84/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.