DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and prss56

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:278 Identity:86/278 - (30%)
Similarity:130/278 - (46%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISE 181
            |.||:|.......|....|          |..:..||.:|.:..:.|..     :..|||.|:.:
 Frog    58 CGQKFSSISNNTGPKGRIV----------GGSITSPGSWPWLVNIRFNG-----ELMCGGVLLDD 107

  Fly   182 RFVLTAAHC--TSIYEAPPKW-VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALL 243
            .::||||||  .|:.|.  .| |.:|..||.  |.:...:..::.::..||.:.:|.:.:|:|||
 Frog   108 MWILTAAHCFTGSVNEV--LWTVVVGQYDLT--KNAQGEKTFQVNRIVTHPKFNQKTFDNDLALL 168

  Fly   244 KLEKEVELTEYVRPVRLWVFPELPT--TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAEL 306
            :|...|..::..|||.|...|..||  |..:..|:|:.....|:::.:....:.|:....|.:.|
 Frog   169 ELTSSVTASQSARPVCLPPVPRDPTPGTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEACRSTL 233

  Fly   307 PPLAETPSGVLESQICAQDYILNR--DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC- 368
                  ...:|.|.:....| ||.  |:|||||||||....|..::     |.|.||||:|..| 
 Frog   234 ------GKNMLTSTMFCAGY-LNGGIDSCQGDSGGPLTCQDPISKQ-----YVLYGITSWGDGCG 286

  Fly   369 RSSYPSVYTRVSSFLDWI 386
            ....|.|||||::|.|||
 Frog   287 ERGKPGVYTRVTAFTDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/249 (32%)
Tryp_SPc 146..386 CDD:214473 78/247 (32%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.