DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and cela1.2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:257 Identity:76/257 - (29%)
Similarity:121/257 - (47%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLA 209
            |..:|:|..:|...::.: ||.|...|.|.|:||...:|:.||||.   ||..|| |.:||.|:.
Zfish    32 GGEIAKPHSWPWQISLQY-SDLGTYYYYCSGTLIRPGWVMVAAHCV---EALRKWTVALGDHDIY 92

  Fly   210 SEKRSVEAQLLRIEQVFAHPNYKKK--MYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTT--- 269
            :.:.  ..|.:.:.:||.|||:...  .:..|||||:|..:..|:.||:      ...||::   
Zfish    93 THEG--PEQYISVSEVFIHPNWNPNNVAFGYDIALLRLSIDATLSSYVQ------VATLPSSGEI 149

  Fly   270 -----IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN 329
                 ..:..|:|.|.....::.:|....:.||....|:.:    ....|.|.|:.|||.. ..:
Zfish   150 LPYGHTCYITGWGYTETGGSLSAQLKQAYMPVVDYETCSQK----DWWGSSVKETMICAGG-TTS 209

  Fly   330 RDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY----GVFCRS-SYPSVYTRVSSFLDWI 386
            ...|.||||.||.....|:       |.:.|:||:    |  |.: ..|:.:||||::::||
Zfish   210 MSACHGDSGSPLNCLFNGK-------YVVHGVTSFVSPEG--CNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/257 (30%)
Tryp_SPc 146..386 CDD:214473 74/255 (29%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 74/255 (29%)
Tryp_SPc 30..265 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.