DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100498532

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:270 Identity:87/270 - (32%)
Similarity:131/270 - (48%) Gaps:51/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRVLARPGEY---PHMAAVGFESDRGQVDYK------CGGSLISERFVLTAAH 189
            ||||.|...|.|.:::   |.|   ||       |...||.:.      |||||||.|::::|||
 Frog    11 AVAAAAPLDDDDDKIV---GGYECTPH-------SQPWQVLFTYNGGNWCGGSLISPRWIISAAH 65

  Fly   190 CTSIYEAPPKWV--RIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELT 252
            |   |: |||.:  .:|:.||  :|:....|.:::|..:.|..||.|.:..||.|:||.|..:..
 Frog    66 C---YQ-PPKTLVALLGEHDL--KKKEGTEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYN 124

  Fly   253 EYVRPVRLWVFPELPTTIA--FAMGYG-ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPS 314
            :||:|:.  |....||..|  ...|:| ...:.....::|..|.:.:|.::.|.|..|.:     
 Frog   125 QYVQPIP--VARSCPTDGAKCLVSGFGNVLGYNVRYPDQLQCLEVPIVSDSSCKASYPRM----- 182

  Fly   315 GVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY-GVFCRS-SYPSVYT 377
             :.|:..||......:.:|.|||||||..|           ..|.|..|: |.:|.| :.|.||.
 Frog   183 -ISENMFCAGFLEGGKGSCHGDSGGPLICN-----------GELYGAVSWGGSYCISKNSPGVYA 235

  Fly   378 RVSSFLDWIE 387
            :|.::||||:
 Frog   236 KVCNYLDWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/256 (31%)
Tryp_SPc 146..386 CDD:214473 78/255 (31%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.