DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:248 Identity:71/248 - (28%)
Similarity:115/248 - (46%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC----TSIYEAPPKW-VRIGDLDLASEK 212
            |::|....:.::...     .||||:|:..:::|||||    ||   :|..| ..||.:.:.|  
 Frog   270 GDWPWQVNLQYDDTN-----LCGGSVIAANWIVTAAHCVQGDTS---SPSLWKAFIGKIKMPS-- 324

  Fly   213 RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL------WVFPELPTTIA 271
             ..::....::::..||:|..:...:||||:||:..:..:...|||.|      |...: |..|:
 Frog   325 -YYDSSAYSVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPVCLPNYGMQWEEGQ-PCYIS 387

  Fly   272 FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGD 336
               |:|.||....:::.|....:.::....||..:    .....:..|.|||.......|:||||
 Frog   388 ---GWGTTSQKGSISSVLKYAMVPLISPTTCNQTI----MYNGAITSSMICAGYPKGGVDSCQGD 445

  Fly   337 SGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY-PSVYTRVSSFLDWIEL 388
            |||||.......       :.|:|.||:|..|.:.| |.||..::.||.||.|
 Frog   446 SGGPLVTKTNSL-------WWLVGDTSWGDGCANVYRPGVYGNMTVFLQWIYL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/245 (28%)
Tryp_SPc 146..386 CDD:214473 68/244 (28%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055
Tryp_SPc 261..489 CDD:238113 68/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.