DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100495222

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031749236.1 Gene:LOC100495222 / 100495222 -ID:- Length:755 Species:Xenopus tropicalis


Alignment Length:267 Identity:75/267 - (28%)
Similarity:124/267 - (46%) Gaps:57/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC------TSIYEAPPKWVRIG 204
            |...|..|.:|..|::.:     |..:.||||:||.::::|||||      ||:|.     ||:|
 Frog   433 GGTAAMNGAWPWQASLQY-----QYSHICGGSVISNKWIMTAAHCFENSLTTSLYR-----VRLG 487

  Fly   205 --DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELP 267
              .|.|:|....:.:    ::.:..:..|..:..:.||||::|...:..|.::.||.      :|
 Frog   488 AYQLSLSSPNEFISS----VKSITVNSQYNSQTNFGDIALVELSSTITYTTFILPVC------VP 542

  Fly   268 TTIA--------FAMGYGATSF-AK-PMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLES--- 319
            ::.|        :..|:|...: || |....|..:...::....|.    .:..|.:||..|   
 Frog   543 SSSANFTAGMECWVTGWGNIGWGAKLPYPQTLQQVMTPLISRDSCE----QMYHTSTGVSSSVTI 603

  Fly   320 ----QICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRV 379
                ||||......:|:|||||||||..|:.|       .::.:||.|:|..|. ::.|.|||.|
 Frog   604 VRVDQICAGYAAGQKDSCQGDSGGPLVCNVQG-------VWYQVGIVSWGEGCALANSPGVYTLV 661

  Fly   380 SSFLDWI 386
            .::..|:
 Frog   662 PNYRSWL 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/267 (28%)
Tryp_SPc 146..386 CDD:214473 74/265 (28%)
LOC100495222XP_031749236.1 Tryp_SPc 41..279 CDD:238113
Tryp_SPc 431..670 CDD:238113 75/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.