DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and prss12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002934300.3 Gene:prss12 / 100495119 XenbaseID:XB-GENE-984837 Length:851 Species:Xenopus tropicalis


Alignment Length:251 Identity:82/251 - (32%)
Similarity:118/251 - (47%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIY--EAPPKWVRIGDL-DLASEKRS 214
            |.:|...|:..:|..|.....||.:|||..:|||||||...|  ......:|:||. .|..|:..
 Frog   616 GGWPWQVALRLKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTRSYVIRVGDYHTLVPEEYE 680

  Fly   215 VEAQLLRIEQVFAHPNYKKKMYYDDIALLKL----EKEVELTEYVRPVRLWVFPELPTTIA---F 272
            .:   :.|:|:..|.:|:......||||::|    |:.|:|:.:|.|..|.:..|.|...|   :
 Frog   681 ED---MTIQQIIIHNDYRPDGNDYDIALIRLHGTAEQCVQLSTHVLPACLPLRRERPQKTASNCY 742

  Fly   273 AMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA-----QDYILNRDT 332
            ..|:|.|..|...|  |....:|::|...|....      .|......:||     |.::   |:
 Frog   743 ITGWGDTGRAYSRT--LQQATVTLLPKRVCEERY------RSQFTGRMLCAGSVKTQKHV---DS 796

  Fly   333 CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIE 387
            |||||||||.....|   |..|.|   |:||:|..|. ...|.|||:||:|:.||:
 Frog   797 CQGDSGGPLVCERSG---GSWIVY---GVTSWGYGCGVKDSPGVYTKVSAFIPWIK 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 81/249 (33%)
Tryp_SPc 146..386 CDD:214473 80/248 (32%)
prss12XP_002934300.3 KR 78..140 CDD:412161
SRCR 148..244 CDD:395421
SR 257..356 CDD:214555
SR 363..461 CDD:214555
SR 476..575 CDD:214555
Tryp_SPc 607..848 CDD:238113 82/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.