DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and f12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:379 Identity:98/379 - (25%)
Similarity:155/379 - (40%) Gaps:91/379 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PELDAGPG----KPEEKMWFHITDFQFDRVEGPTQPKPKPRQYPPP----------PMPGQPFPP 101
            |:.|..|.    |.:...|.|....:..::.|.|.| ||..:.|.|          |.|......
 Frog   270 PDGDTQPWCFVMKEQRLSWEHCLIPRCTQLAGTTAP-PKVTKTPSPTKSSNHSASTPSPSNDTQG 333

  Fly   102 PPGGFKKKENKQRRL-----CEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAV 161
            |..|         |:     |.:|:.: ...|.|.            ..|.::|.|..:|::||:
 Frog   334 PVDG---------RIDLPVDCGRKFQK-TPSIMPR------------IVGGLVALPASHPYIAAL 376

  Fly   162 GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQ---LLRIE 223
            ..:      ::.|||||||..:::|||||   .:..|...:| .:.|...:.:...|   .|.:|
 Frog   377 YID------NHFCGGSLISPCWIVTAAHC---LDQRPNVTKI-SVVLGQSRFNTTDQHTVTLLVE 431

  Fly   224 QVFAHPNYKKKMYYDDIALLKLEK-----EVELTEYVRPVRL-WVFPELPTT---IAFAMGY--- 276
            :...|..|.......||||:|::.     ..|.:::|:|:.| ..|....:|   :....|:   
 Frog   432 KYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFKMAESTKQCVVAGWGHQYE 496

  Fly   277 GATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPS----GVLESQICAQDYILNRDTCQGDS 337
            ||..:|    ..|...::.::|..:|        ::||    .:|...:||.......|.|||||
 Frog   497 GAEHYA----FFLQEASMPIIPYTQC--------QSPSVHGDRMLPGMLCAGFMEGGVDACQGDS 549

  Fly   338 GGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            ||||...:.|     ||..|  |:.|:|..| ..:.|.|||.|:|:.|||...:
 Frog   550 GGPLVCEVDG-----RIELH--GVVSWGSGCAEENKPGVYTAVTSYTDWIRANI 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/260 (29%)
Tryp_SPc 146..386 CDD:214473 74/259 (29%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527 6/27 (22%)
Tryp_SPc 359..595 CDD:238113 76/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.