DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and corin

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_004911266.2 Gene:corin / 100492163 XenbaseID:XB-GENE-950958 Length:1123 Species:Xenopus tropicalis


Alignment Length:254 Identity:77/254 - (30%)
Similarity:122/254 - (48%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESD-RGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW---VRIGDL 206
            ||. :|||.:|...::  :|| .|.:   ||..||.:::|||.|||....|:...|   ..|.:|
 Frog   886 GRT-SRPGRWPWQCSL--QSDPSGHI---CGCVLIGKKWVLTVAHCFEGRESAAVWKVVFGINNL 944

  Fly   207 DLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL--PTT 269
            |..|:    .||...::::..||.|.:.:...||::::|.:::..|.|||||.|....:|  |.|
 Frog   945 DHPSD----FAQTRLVKKIILHPRYNRAVVDYDISIVELNEDITETSYVRPVCLPTKGQLVEPDT 1005

  Fly   270 IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQ 334
            ..:..|:|  .....|..:|....:.::....|.:..     ....:....:||.......|:|.
 Frog  1006 YCYITGWG--HMGNKMPFKLQEGEVRIISLERCQSYF-----DMKTITSRMLCAGYESGTIDSCM 1063

  Fly   335 GDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY--PSVYTRVSSFLDWIELTVW 391
            |||||||....||.:      :.|.|:||:|..|.|..  |.||:.||.|::|||..::
 Frog  1064 GDSGGPLVCEKPGGK------WTLYGLTSWGSVCFSKVLGPGVYSNVSHFVEWIERQIY 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/248 (30%)
Tryp_SPc 146..386 CDD:214473 74/247 (30%)
corinXP_004911266.2 CRD_corin_1 213..341 CDD:143554
LDLa 351..382 CDD:238060
LDLa 384..418 CDD:238060
LDLa 420..455 CDD:238060
LDLa 465..492 CDD:238060
CRD_corin_2 533..654 CDD:143579
LDLa 659..693 CDD:238060
LDLa 734..768 CDD:238060
Tryp_SPc 883..1114 CDD:238113 77/250 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.