DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100491119

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_004916446.1 Gene:LOC100491119 / 100491119 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:274 Identity:67/274 - (24%)
Similarity:121/274 - (44%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IFPNDTAVA---ADANDADFD-----GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFV 184
            |.|....|:   .|...|..|     |...:..|::|...::.::.     .:.||||:||.::|
 Frog   251 ICPTQEGVSLQCTDCGQASVDIPRIVGGTDSSLGKWPWQVSLRWDG-----RHMCGGSIISSQWV 310

  Fly   185 LTAAHCTSI--YEAPPKW-VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLE 246
            ::||||..:  :....:| :..|.:.|::      .....:..::.:..|..:....|:||||..
 Frog   311 MSAAHCFVLNGFLTVSRWKIHAGSISLST------GIAYSVRNIYYNGLYSLETNDYDVALLKTT 369

  Fly   247 KEVELTEYVRPVRL-WVFPELPTTI-AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPL 309
            ..:..::..|||.| ..:.:...|. .:.:|:|..|....::..|....:.::.:..||.     
 Frog   370 VPMSFSDTTRPVCLPRAYQQFQVTANCWIIGWGHVSEGGQLSPVLQEAKVQLISSQICNH----- 429

  Fly   310 AETPSGVLESQICAQDYILNR-DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSY 372
            :...:|.:..::....|...| |:|||||||||.....|.       :..:||.|:|..| |.:.
 Frog   430 SSNYAGQISPRMLCAGYPDGRADSCQGDSGGPLVCQEGGL-------WWQVGIVSWGEGCGRPNR 487

  Fly   373 PSVYTRVSSFLDWI 386
            |.|||.::..|||:
 Frog   488 PGVYTNLTEVLDWV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 61/248 (25%)
Tryp_SPc 146..386 CDD:214473 60/246 (24%)
LOC100491119XP_004916446.1 SRCR_2 172..269 CDD:373897 4/17 (24%)
Tryp_SPc 275..501 CDD:238113 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.