DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:248 Identity:80/248 - (32%)
Similarity:126/248 - (50%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYE-APPKW--VRIGDLDLASEKRS 214
            |::|..|::.|     |..:.||||||:.::::|||||  :|: ..|:|  |::|.:..|||...
 Frog   253 GQWPWQASLVF-----QGVHLCGGSLITPQWIVTAAHC--VYDLLYPEWWRVQVGQVSQASESAQ 310

  Fly   215 VEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL----WVFPELPTTIAFAMG 275
            .   .:.::::..|..|:.....:||||::|.........::|:.|    ..|||  ..|.:..|
 Frog   311 T---AVPVQKIIYHSKYRSSTMANDIALIRLASPFTFNGSIQPICLPNYREDFPE--GKICWISG 370

  Fly   276 YGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE-SQICAQDYILNRDTCQGDSGG 339
            :|||......:..:....:.::.|..||.:.     ...||:: |.:||.......|||||||||
 Frog   371 WGATEEGGDTSQTMDYAGVPLISNRVCNTKY-----IYGGVIKPSMVCAGFLEGGVDTCQGDSGG 430

  Fly   340 PL---QLNLPGRRRGHRIHYHLIGITSYGVFCRSSY-PSVYTRVSSFLDWIEL 388
            ||   ..|:          :.|:|.||:|:.|...| |.||||:|||||||.:
 Frog   431 PLACEDSNV----------WKLMGTTSWGIGCALRYKPGVYTRISSFLDWIHI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/245 (32%)
Tryp_SPc 146..386 CDD:214473 78/244 (32%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055
Tryp_SPc 244..472 CDD:238113 79/245 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.