DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100490440

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002939183.3 Gene:LOC100490440 / 100490440 -ID:- Length:565 Species:Xenopus tropicalis


Alignment Length:286 Identity:58/286 - (20%)
Similarity:86/286 - (30%) Gaps:94/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CLSNTHT-------QRLPPEGRMRPLQDDSIRSPVDRDIVFPELDAGPGKPEEKMWFHITDFQFD 74
            |:..||.       :|...:...|......|||.|:..:|      |.|....|.      |...
 Frog   141 CMVQTHADLVLHTEKRRQGKSYWRRQTLQGIRSRVEERLV------GAGLQGCKA------FLIS 193

  Fly    75 RVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRL-------CEQ----KYSEYVERI 128
            .:|..:...|....|    |.|:....|..|....||:.:.|       |:|    ::..|:..:
 Frog   194 ALEPQSFDFPSMMDY----MEGEILQWPRSGEDNVENQCQELVSVFEMPCDQEGLVEFPPYLSIL 254

  Fly   129 F------PNDTAVAADANDADFDG-----------RVLARPGEYP-----HMAAVGFESDRGQVD 171
            .      |....||....|....|           :.|..||..|     ::..:..||....:.
 Frog   255 LDIPPPVPAIVGVAGSNKDTILHGLSDPPMSGLLVKALPGPGNPPLPVDQYLENLQLESCDVYLI 319

  Fly   172 YKCG-----GSLISERFVLTAAHCTSI--------------YEAPPKWVRIGDLDL-----ASEK 212
            .:.|     .:.:.|..|....||..|              ::...|...:|..||     |.||
 Frog   320 VESGLNNSFRATLVEALVAAGKHCMLIAGEGRQSGEEKEPGHDGEGKRAYLGATDLRGLKVALEK 384

  Fly   213 --------------RSVEAQLLRIEQ 224
                          .|:.|||:|.||
 Frog   385 GAPQLVRERLLHCLPSIVAQLVRREQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 27/133 (20%)
Tryp_SPc 146..386 CDD:214473 27/133 (20%)
LOC100490440XP_002939183.3 P-loop_NTPase 32..218 CDD:422963 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.