DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss15

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:285 Identity:75/285 - (26%)
Similarity:138/285 - (48%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CEQKYSEYVERIFP-NDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLIS 180
            |:|:  |..:|:.| ...:.....:||..        |.:|.:.:: :.:||    ..||.||::
 Frog   742 CQQR--ECGKRLVPIKSGSKIVGGSDAAL--------GAWPWIVSL-YYNDR----QTCGASLVN 791

  Fly   181 ERFVLTAAHCTSIYE---APPKW-VRIG---DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYD 238
            :.::::||||  :|.   .|..| .|:|   :|:|...:  :..|:  |:|:..:|.|.::....
 Frog   792 QEWLVSAAHC--VYGRNLIPSNWKARLGLHTNLNLTQPQ--IATQM--IDQIVINPQYNRRTKDS 850

  Fly   239 DIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAM-----GYGATSFAKPMTNRLTNLNLTVVP 298
            ||.::.|:.:|..::|::|:.|   ||.....:..:     |:|.|....|:.|.|....:.::.
 Frog   851 DIVMMHLQFKVNYSDYIQPICL---PETDQEFSVGINCSIAGWGRTQSGGPVPNILQEAEIPLIS 912

  Fly   299 NAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITS 363
            |.:|..::|..     .:.::.:|........||||||||||:...       ....:.|:|:||
 Frog   913 NHKCQQQMPEY-----NITDNMVCGGYEEGGIDTCQGDSGGPMMCQ-------QNNEWFLVGVTS 965

  Fly   364 YGVFC-RSSYPSVYTRVSSFLDWIE 387
            :|..| :.|.|.||.||:.|.:||:
 Frog   966 FGYGCAQPSRPGVYVRVTEFTNWIK 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 67/253 (26%)
Tryp_SPc 146..386 CDD:214473 66/252 (26%)
tmprss15XP_031752048.1 SEA 36..>103 CDD:396113
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:395504
CUB 501..608 CDD:395345
LDLa 620..654 CDD:238060
SR 655..746 CDD:214555 2/5 (40%)
Tryp_SPc 760..991 CDD:238113 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.