DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss9

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:240 Identity:78/240 - (32%)
Similarity:122/240 - (50%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVR-IGDLDLASEKRSVE 216
            ||:|...::...    :.::|||..|||:|::|:||||..||..|..|.. :|...|    ..||
 Frog   928 GEWPWQVSLWLR----RKEHKCGAVLISDRWLLSAAHCFDIYSDPKLWAAYLGTPFL----NGVE 984

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL----WVFPELPTTIAFAMGYG 277
            .::.:|.::..||.|......:|:|||:|...:..|..:||:.|    .:|||  .|..|..|:|
 Frog   985 GRVEKIFRIHKHPFYNVYTLDNDVALLELPSPLTYTNLIRPICLPDISHIFPE--GTRCFITGWG 1047

  Fly   278 ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQ 342
            :|.....|:.:|...::::|.:..|. :..|:..:|     ..:||.......|:|.||:||||.
 Frog  1048 STKEGGAMSRQLQKASVSIVGDQTCK-KFYPIQISP-----RMLCAGFMQGGVDSCSGDAGGPLA 1106

  Fly   343 LNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ...|..|      :.|.||||:|..| |..:|.||||::|..:||
 Frog  1107 CREPSGR------WFLAGITSWGYGCARPYFPGVYTRITSVRNWI 1145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/240 (33%)
Tryp_SPc 146..386 CDD:214473 76/238 (32%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113 76/238 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.