DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss6

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:253 Identity:75/253 - (29%)
Similarity:127/253 - (50%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC--TSIYEAPPKW-VRIGDLD 207
            |...|:.||:|..|::   ..||  ::.|||:|::::::||||||  ...|.:|..| |.:|.:.
 Frog   573 GGTQAQEGEWPWQASL---QVRG--EHICGGTLVADQWILTAAHCFTPESYASPEVWTVYLGKVR 632

  Fly   208 LASEKRSVEAQL-LRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTE-YVRPVRLWVFP----EL 266
            |:   ||.:.:| .::.::..||.|.:..:..|:||:.|:..|.||. :|:|:.|   |    ..
 Frog   633 LS---RSTQKELAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICL---PSSTHHF 691

  Fly   267 PT-TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNR 330
            || :..:..|:|:.....|.::.|..:::.:|....| .||.....:|     ..:||.....::
 Frog   692 PTGSSCWVTGWGSVKENGPTSDVLQKVDIQLVAQDIC-TELYRYQISP-----RMLCAGYRDGSK 750

  Fly   331 DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIE 387
            |.||||||.||.......|      :...|:.|:|..|. ..|..||:|::..:.|||
 Frog   751 DACQGDSGSPLVCKTASGR------WFQAGLVSWGAGCGIPRYFGVYSRITRLVQWIE 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/251 (29%)
Tryp_SPc 146..386 CDD:214473 72/250 (29%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113 75/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.