DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and klkb1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002934450.3 Gene:klkb1 / 100486524 XenbaseID:XB-GENE-985051 Length:629 Species:Xenopus tropicalis


Alignment Length:286 Identity:82/286 - (28%)
Similarity:125/286 - (43%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RLCEQKY-------SEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDY 172
            |||:.|.       .|:..||.....:|.                ||:|...::..........:
 Frog   371 RLCKIKSVKGCGEPIEHANRIVGGTDSVL----------------GEWPWQVSMHLRLTASYKKH 419

  Fly   173 KCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMY 236
            .||||:||.::::|||||.:::..|..| :..|.:.|::..:|  ......||:..||:|.....
 Frog   420 ACGGSIISNQWIVTAAHCFAMHPLPQMWIIYSGVVKLSNITQS--TPFSETEQIIIHPHYTGAGN 482

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI----AFAMGYGATSFAKPMTNRLTNLNLTVV 297
            ..|||||||:..:...::.:.:.|  .|..||.:    .:..|:|.|..:..:.|.|....:..:
 Frog   483 GTDIALLKLKTPISFNDHQKAICL--PPREPTFVLPNSCWITGWGFTEESGSLANILQKAEVPQI 545

  Fly   298 PNAECNAELPPLAETPSGVLESQICAQDYILNR-DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGI 361
            ...||........      ::.:|....|...: |:|:|||||||...:      ..|.| |.||
 Frog   546 STEECQGNYEQTR------IDKKILCAGYKRGKIDSCKGDSGGPLACVV------DEIWY-LTGI 597

  Fly   362 TSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ||:|..| |...|.||||||.|.|||
 Frog   598 TSWGEGCARPGKPGVYTRVSEFTDWI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 74/248 (30%)
Tryp_SPc 146..386 CDD:214473 72/246 (29%)
klkb1XP_002934450.3 APPLE 21..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 290..373 CDD:128519 1/1 (100%)
Tryp_SPc 391..626 CDD:238113 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.