DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100485189

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:272 Identity:77/272 - (28%)
Similarity:124/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAVAADANDADFDGRVL----ARPGEYP-HMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS 192
            :|:...|..|.:..|::    .||...| |.:...|:      .:.|||.||.|.:|||||||  
 Frog     7 SALLGTAVQARYYDRIIGGTECRPNSQPWHCSLYYFD------QHVCGGVLIDENWVLTAAHC-- 63

  Fly   193 IYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
              :.....||:|:.:||..:.  :.|....|::..|..:....:.:||.||||...|.:.:||:.
 Frog    64 --QLSSLQVRLGEHNLAVYEG--KEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQT 124

  Fly   258 VRLWVFPELPTT----IAFAMGYG-ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL 317
            :.|    ..||.    .....|:| .||..:...:.|..:.:..|....|....|     ...:.
 Frog   125 IPL----GCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQGAFP-----TDEIT 180

  Fly   318 ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG-VFCR-SSYPSVYTRVS 380
            ::.:||......:|:|||||||||..|       ..:|    ||||:| ..|. ::.|.:||::.
 Frog   181 DNMLCAGVMEGGKDSCQGDSGGPLVCN-------SMVH----GITSWGNTPCGVANKPGIYTKIC 234

  Fly   381 SFLDWIELTVWA 392
            :::.||:.|:.|
 Frog   235 NYIAWIQDTIAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/252 (28%)
Tryp_SPc 146..386 CDD:214473 70/251 (28%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.