DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss11f

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:270 Identity:75/270 - (27%)
Similarity:125/270 - (46%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAVAADANDADFDG-----RVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAA 188
            |..|||.......|     |::    |..|.:|..|::     |....:.||.||:::.:::.||
 Frog   177 TTTAADFTACGIGGPSVSNRIVGGTNAGLGSWPWQASL-----RLLGSHTCGASLLNDTWLVAAA 236

  Fly   189 HCTSIYEAPPKW-VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELT 252
            ||..:......| |.:|.:::.|...      .:||::..:..|....:.:|||||||...:..|
 Frog   237 HCFDMNADANSWTVVLGTINVYSGSE------FKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFT 295

  Fly   253 EYVRPVRL----WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETP 313
            ..:|||.|    .:||:  .:..:..|:||.:.....:..|....:.::.:..|::     ::..
 Frog   296 SIIRPVCLPEASDIFPD--GSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSS-----SQMY 353

  Fly   314 SGVL-ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVY 376
            .|:: .|.|||.......|:|||||||||.....||       :.||||.|:|..|. .:.|.||
 Frog   354 GGLIYPSMICAGYATGQIDSCQGDSGGPLVTLKSGR-------WVLIGIVSFGYGCALPNKPGVY 411

  Fly   377 TRVSSFLDWI 386
            :|::...:||
 Frog   412 SRITYLRNWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/257 (28%)
Tryp_SPc 146..386 CDD:214473 69/255 (27%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 67/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.