DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100361261

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038949773.1 Gene:LOC100361261 / 100361261 -ID:- Length:248 Species:Rattus norvegicus


Alignment Length:266 Identity:74/266 - (27%)
Similarity:121/266 - (45%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC--TSIYE 195
            |...||   |.::    |:|...|:||.:.. .|....:..|||.||.|.||||||||  : |. 
  Rat    13 APKTDA---GEIIGGHEAKPHSRPYMAYLQI-MDENSGNKTCGGFLIREYFVLTAAHCLGSXII- 72

  Fly   196 APPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL 260
                 |.:|..::..:::  :.|::.:.::..||.|..|...:|:.||||:.:.:.|..|:.:.|
  Rat    73 -----VTLGAHNIKEQEK--KQQVIPMVKIIPHPAYNAKTISNDLMLLKLKIKAKKTSAVKTLNL 130

  Fly   261 WVFPE-----LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ 320
               |.     .|..:.:..|:|.........:.|..:.|.|..:.:|.:.|..:.:.     .::
  Rat   131 ---PRSNVKVKPGDVCYVAGWGKLGPMGKFPDTLQEVELIVQEDQKCESYLTNVYDK-----ANE 187

  Fly   321 ICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLD 384
            .||.:..:...:.||||||||......           .||.|||  |: .|.|..:|:||:||.
  Rat   188 KCAGEPKIKHASFQGDSGGPLVCKKVA-----------AGIVSYG--CKDGSTPRAFTKVSTFLS 239

  Fly   385 WIELTV 390
            .|:.|:
  Rat   240 RIKKTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/252 (27%)
Tryp_SPc 146..386 CDD:214473 69/251 (27%)
LOC100361261XP_038949773.1 Tryp_SPc 21..244 CDD:238113 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.