DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Mcpt1l1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001264597.1 Gene:Mcpt1l1 / 100360872 RGDID:2321286 Length:260 Species:Rattus norvegicus


Alignment Length:260 Identity:78/260 - (30%)
Similarity:116/260 - (44%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYK--CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDL 208
            |.|.:||...|:||.:...::||   ||  |||.|::.:||:|||||    :.....|.:|..|:
  Rat    23 GGVESRPHSRPYMAHLEITTERG---YKATCGGFLVTRQFVMTAAHC----KGRETTVTLGVHDV 80

  Fly   209 ASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE-----LPT 268
            :  |.....|.:::|:...||||.......||.||||:|:.::|..|..:.|   |:     .|.
  Rat    81 S--KTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPL---PQPSDFLKPG 140

  Fly   269 TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAEC------NAELPPLAETPSGVLESQICAQDYI 327
            .:..|.|:|.|...||.:|.|..:...::....|      |...             |:|.....
  Rat   141 KMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNF-------------QVCVGSPR 192

  Fly   328 LNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR--SSYPSVYTRVSSFLDWIELTV 390
            ..|...:|||||||..       ....|    ||.|||   |  :..|:|:||:|.::.||...:
  Rat   193 KIRSAYKGDSGGPLVC-------AGVAH----GIVSYG---RGDAKPPAVFTRISPYVPWINKVI 243

  Fly   391  390
              Rat   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/255 (30%)
Tryp_SPc 146..386 CDD:214473 76/254 (30%)
Mcpt1l1NP_001264597.1 Tryp_SPc 20..239 CDD:214473 76/254 (30%)
Tryp_SPc 21..242 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.