DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and hpn

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_012811934.1 Gene:hpn / 100145343 XenbaseID:XB-GENE-995348 Length:417 Species:Xenopus tropicalis


Alignment Length:270 Identity:70/270 - (25%)
Similarity:109/270 - (40%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--------GDLDLA 209
            |.:|...::.::.     .:.|||||||..:|||||||.      |:..||        |    |
 Frog   172 GRWPWQVSLRYDG-----AHLCGGSLISSEWVLTAAHCF------PERNRIVSQWRVFAG----A 221

  Fly   210 SEKRSVEAQLLRIEQVFAHPNYKKKMYYD------DIALLKLEKEVELTEYVRPVRLWVFPE--L 266
            ..:.|...:||.::.:..|..|...:..|      ||||:.|...|.|:||::||.|....:  :
 Frog   222 VSQLSPRGKLLGVKGIIYHSGYLPFLNPDSEENSNDIALVHLASPVTLSEYIQPVCLPALGQQII 286

  Fly   267 PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNR- 330
            ...|....|:|...:....:..|...::.::.::.||                   ..:|.:|: 
 Frog   287 DGKICTVSGWGNLQYYGQQSEILQEASVPIISSSVCN-------------------QPEYYMNQI 332

  Fly   331 --------------DTCQGDSGGPL----QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVY 376
                          |.||||||||.    .|:...|       :.|.||.|:|:.| ..:.|.||
 Frog   333 TGKMFCAGYAEGGIDACQGDSGGPFVCEDTLSRSSR-------WRLCGIVSWGIGCAMPNKPGVY 390

  Fly   377 TRVSSFLDWI 386
            .:|..:..||
 Frog   391 AKVDQYQYWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/270 (26%)
Tryp_SPc 146..386 CDD:214473 68/268 (25%)
hpnXP_012811934.1 Hepsin-SRCR 50..159 CDD:370400
Tryp_SPc 163..400 CDD:238113 68/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.