DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and zgc:171509

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:226 Identity:70/226 - (30%)
Similarity:110/226 - (48%) Gaps:42/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHC--TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMY 236
            ||||||.|.:|::||||  :||.      |.:|..||...:.:  ||.::.|:|.:||.|..:.:
Zfish    45 CGGSLIHESWVVSAAHCKSSSII------VHLGKHDLFVVEDT--AQEIQAEKVISHPKYNNREH 101

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFA------MGYGATSFAKPMTNRLTNLNLT 295
            .:||.|:||.:...:...|:||      .|||..:.|      .|:|.|  ...:::.|..|.|.
Zfish   102 NNDIMLIKLREPAVINNNVKPV------PLPTNCSHAGEQCLVSGWGVT--GDSISSTLQCLELP 158

  Fly   296 VVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIG 360
            ::..|:|.:....:      :.:...||......:|:||||||||:..|  |.         |.|
Zfish   159 ILSKADCKSAYGRV------ITKKMFCAGFMDGGKDSCQGDSGGPVVCN--GT---------LKG 206

  Fly   361 ITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            |.|:|:.| ...:|.||..|..:::||...:
Zfish   207 IVSFGIGCAEPGFPGVYVEVCRYINWINYII 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/221 (31%)
Tryp_SPc 146..386 CDD:214473 68/220 (31%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 68/220 (31%)
Tryp_SPc 21..234 CDD:238113 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.