DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:244 Identity:78/244 - (31%)
Similarity:123/244 - (50%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS 214
            |.||.:|...::.:........::||||||...:||:||||......|..|..:..|.....:.|
 Frog    47 ALPGAWPWQVSLQYFRTLSGYSHRCGGSLIQNNWVLSAAHCFRANRNPEYWRAVLGLHNIFMEGS 111

  Fly   215 --VEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLW--VFPELPTTIAFAMG 275
              |:|   :|:|:..|.:|......:|||||.|...|..::|:.||.|.  ..|: ..|..|..|
 Frog   112 PVVKA---KIKQIIIHASYDHIAITNDIALLLLHDFVTYSDYIHPVCLGSVTVPD-SLTACFITG 172

  Fly   276 YGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQICAQDYILNRDTCQGDSGG 339
            :|.|.....::..|....:..:|.:|||:     :.:.:| :.:|.|||.|.....|:|||||||
 Frog   173 WGVTKEKGSISVILQEALVQTIPYSECNS-----SSSYNGFITQSMICAGDNSGAVDSCQGDSGG 232

  Fly   340 PLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            |...     ....|:.::.:||||:|..| :.::|.|||:|.|::.||:
 Frog   233 PFVC-----YNTERMRFYQMGITSFGYGCGKPNFPGVYTKVESYVSWIK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/242 (32%)
Tryp_SPc 146..386 CDD:214473 76/241 (32%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.