DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and f7l

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:278 Identity:88/278 - (31%)
Similarity:131/278 - (47%) Gaps:57/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 ADFD-GRVLAR-------------PGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS 192
            |||. ||.:|:             .|:.|..|.:.::   ||  |||||.:::.::::|||||  
Zfish   179 ADFSCGRPVAKGVGPRIVKGDVCPKGQCPWQALLEYD---GQ--YKCGGVILNSQWIITAAHC-- 236

  Fly   193 IYEAPPKWVR------IGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVEL 251
            |:...|..::      |.|.|..:|      |:.::.:||.||.|.......|:|||:|.:.|.|
Zfish   237 IWRKDPALLQVIVGEHIRDRDEGTE------QMRKVSEVFLHPQYNHSSTDSDVALLRLHRPVTL 295

  Fly   252 TEYVRPVRL----WVFPELPTTIAFA--MGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLA 310
            ..|..||.|    ..|.....:|..:  .|:|..:.:.|.:..|..|.:..|.:.:|.|.     
Zfish   296 GPYALPVCLPPPNGTFSRTLASIRMSTVSGWGRLAQSGPPSTVLQRLQVPRVSSEDCRAR----- 355

  Fly   311 ETPSG--VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSY 372
               ||  |..:.:||......||:|||||||||...       :|..:.|.||.|:|..| |:..
Zfish   356 ---SGLTVSRNMLCAGFAEGGRDSCQGDSGGPLVTR-------YRNTWFLTGIVSWGKGCARADV 410

  Fly   373 PSVYTRVSSFLDWIELTV 390
            ..:|||||.|::||..||
Zfish   411 YGIYTRVSVFVEWILKTV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/268 (31%)
Tryp_SPc 146..386 CDD:214473 81/267 (30%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.