DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC100004411

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:258 Identity:79/258 - (30%)
Similarity:118/258 - (45%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD 205
            |....|..|.|.|..|....:..|.:.|    .||||||::|:|:|||||   .:..|..:.|||
Zfish   246 DTRIVGGQLQRQGGSPWQVLLRREDEYG----FCGGSLINQRWVITAAHC---LQQTPHHITIGD 303

  Fly   206 LD-LASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL--- 266
            .| :..:|   :.|.:.:|::..||:|.:..:..|||||.|...|.|..:..|..|   |:.   
Zfish   304 YDKMRPDK---DEQKITVEKIIPHPHYHEYTFDSDIALLYLSSAVTLGPFASPACL---PDANLA 362

  Fly   267 -----PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDY 326
                 |.......|:|:|.:.:..:..|..:.|.||....|      :..|...:.::..||...
Zfish   363 ERLMKPGEQGLVSGWGSTHYLQRSSRFLRKVQLPVVEQKSC------INSTEQIITDNMFCAGFL 421

  Fly   327 ILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS--SYPSVYTRVSSFLDWIE 387
            :...|.|.||||||..:|..|.       :.|.|:.|:|..|.|  .| .||||:.::|.||:
Zfish   422 MEEMDACTGDSGGPFIVNYRGT-------WFLTGVVSWGERCASQGKY-GVYTRLGNYLSWIQ 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/251 (31%)
Tryp_SPc 146..386 CDD:214473 76/250 (30%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 76/253 (30%)
Tryp_SPc 249..477 CDD:238113 78/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.