DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and gzm3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001122022.1 Gene:gzm3 / 100000986 ZFINID:ZDB-GENE-070912-132 Length:253 Species:Danio rerio


Alignment Length:271 Identity:72/271 - (26%)
Similarity:126/271 - (46%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ADANDADFDGRVLARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPK 199
            |...|:...|..:|:|...|:||.:  .||:        |||.||.:.::||||||.:..:....
Zfish    15 AGGMDSGIIGGKVAKPHSRPYMAFIQNKFEA--------CGGMLIRDDYILTAAHCLNNNDRSHF 71

  Fly   200 WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNY----KKKMYYDDIALLKLEKEVELTEYVRPVRL 260
            .|.:|..:::..::|  .|.:::::...||.:    .:|.|..||.||||:.:.::.::|:.:.|
Zfish    72 EVVLGAHNISKHEKS--QQRIQVKKHIQHPMFLNSNNEKDYSYDIMLLKLKNKAKINKFVKVLSL 134

  Fly   261 WVFP----ELPTTIAFAM-GYGA--TSFAKPMTNRLTNLNLTVVPNAECNAE----LPPLAETPS 314
               |    :||..:..:: |:|.  ::..|| ::.|..:.:.:..|.||..:    ..|      
Zfish   135 ---PKKNEKLPENVKCSIAGWGTKESNGNKP-SDVLEEVTVKLQNNHECERKWQQHFNP------ 189

  Fly   315 GVLESQICA-QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGV--FCRSSYPSVY 376
               |...|: .|.  ....|:||||.||..|...:           .|.||.|  .|..::|.|:
Zfish   190 ---ERMFCSVSDG--KHAFCRGDSGSPLICNTKPQ-----------AIASYTVKKDCLHTHPQVF 238

  Fly   377 TRVSSFLDWIE 387
            .::|.||.||:
Zfish   239 VKISCFLPWIK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/260 (27%)
Tryp_SPc 146..386 CDD:214473 68/259 (26%)
gzm3NP_001122022.1 Tryp_SPc 22..251 CDD:238113 70/264 (27%)
Tryp_SPc 22..248 CDD:214473 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.