DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss3a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:256 Identity:75/256 - (29%)
Similarity:118/256 - (46%) Gaps:34/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FDGRV----LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWV--- 201
            |..|:    |:..|::|...::.|::     ::.||||:|:.|::||||||......|..|:   
Zfish   294 FSARIVGGNLSAEGQFPWQVSLHFQN-----EHLCGGSIITSRWILTAAHCVYGIAYPMYWMVYA 353

  Fly   202 RIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL 266
            .:.:|.|.:.|      ...:|::..|..|:.|....||||:||.:.:.....|.|:.|..|.|.
Zfish   354 GLTELPLNAVK------AFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICLPNFGEQ 412

  Fly   267 --PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLES-QICAQDYIL 328
              ...:.:..|:|||......:......::.::.|..|:.     .|...|.|.: .|||.....
Zfish   413 FEDGKMCWISGWGATEDGGDASVSQHCASVPLISNKACSQ-----PEVYQGYLTAGMICAGYLDG 472

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIEL 388
            ..|:|||||||||...       ....:.|:|.||:|..| ..:.|.||||::..|.||.|
Zfish   473 GTDSCQGDSGGPLACE-------DSSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWIHL 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/251 (29%)
Tryp_SPc 146..386 CDD:214473 71/250 (28%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845
Tryp_SPc 298..525 CDD:238113 71/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.