DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abs and Rm62

DIOPT Version :9

Sequence 1:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster


Alignment Length:471 Identity:174/471 - (36%)
Similarity:252/471 - (53%) Gaps:35/471 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 VAELAKGIQYEQPIKTAWKPPRYIREMSEEEREAVRHELRILVEGETPSPPIRSFREMKFPKGIL 189
            :|...|....|.|         .:...|..|.:..|.|..|.|.|:.|: ||:.|.|:..|..::
  Fly   239 LAPFKKNFYQEHP---------NVANRSPYEVQRYREEQEITVRGQVPN-PIQDFSEVHLPDYVM 293

  Fly   190 NGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLPFERNEGP 254
            ..:..:|.|.||.||.||.|..::|.:.:|||.|||||||.::||.|:....|:   |.:|.:||
  Fly   294 KEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ---PLQRGDGP 355

  Fly   255 YGLIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVATPGR 319
            ..|::.|:||||:|..::...:.      ....:|:....||.|....:..:.||..||:|||||
  Fly   356 IALVLAPTRELAQQIQQVATEFG------SSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGR 414

  Fly   320 LMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARS 384
            |:|.|......|..|.||.:||||||:|||||..:|.|.|..:..||||::|||.||:::..|..
  Fly   415 LIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAED 479

  Fly   385 ALVKPVTINVGRAG-AASMNVTQQV----EYVKQEAKVVYLLDCLQKTAPP--VLIFAEKKQDVD 442
            .|...:.||:|... :|:.|:.|.|    |:.|:|.....|.|....:..|  ::||.|.|:.||
  Fly   480 FLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVD 544

  Fly   443 CIHEYLLLKGVEAVAIHGGKDQEERSRAVDAYRVGKKDVLVATDVASKGLDFPNVQHVINYDMPD 507
            .:..::...||...||||.|.|.||...:..:|.||.::|||||||::|||...:::|||:|.|.
  Fly   545 NLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQ 609

  Fly   508 DIENYVHRIGRTGRSNTKGLATTLI--NKTTEQSVLLDLKHLLIEGKQEVPDFLDELAPETEHQH 570
            :.|:|:|||||||||||||.:....  |...:...|:|   :|.|..||:...|:.||..:.:. 
  Fly   610 NSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVD---VLREANQEINPALENLARNSRYD- 670

  Fly   571 LDLGDSHGCTYCGGLG 586
               |......|.||.|
  Fly   671 ---GGGGRSRYGGGGG 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
absNP_524220.1 DEADc 179..393 CDD:238167 83/213 (39%)
DEXDc 192..397 CDD:214692 83/204 (41%)
Helicase_C 414..523 CDD:278689 48/110 (44%)
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 152/387 (39%)
DEADc 283..488 CDD:238167 83/213 (39%)
HELICc 499..633 CDD:238034 58/133 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.