DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abs and ddx41

DIOPT Version :9

Sequence 1:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_017214653.1 Gene:ddx41 / 394020 ZFINID:ZDB-GENE-030131-1927 Length:136 Species:Danio rerio


Alignment Length:132 Identity:69/132 - (52%)
Similarity:92/132 - (69%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSKSSEEGDLDNEDYVPYVPVKERKKQHMIKLGRI-VQLVSETAQPKSSSENENEDDSQGAHDVE 73
            |.||:.||. :::|||||||||.||:|.:.|:.|: .:.::|..|..|..|.::||        |
Zfish    13 SEKSASEGS-EDDDYVPYVPVKIRKQQMLQKVMRLRGKGLTEEEQKDSGGEQKDED--------E 68

  Fly    74 TWGRKYNISLLDQHTELKKIAEAKKLSAVEKQLREEEKIMESIAQQKALMGVAELAKGIQYEQPI 138
            ..|.:.|:||||||..||:.|||:|.||.||||:|||||:||:|:.:|||.|.|:||||.||.||
Zfish    69 GLGPRSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYEDPI 133

  Fly   139 KT 140
            ||
Zfish   134 KT 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
absNP_524220.1 DEADc 179..393 CDD:238167
DEXDc 192..397 CDD:214692
Helicase_C 414..523 CDD:278689
ddx41XP_017214653.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9431
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D183201at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.