DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14641 and NAM8

DIOPT Version :9

Sequence 1:NP_649440.3 Gene:CG14641 / 40529 FlyBaseID:FBgn0037220 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:66/255 - (25%)
Similarity:96/255 - (37%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 NEPDDPLCEQNIKDRYY---------GRND-------------PVAEKIMKRAASLPTLEPPEDR 229
            |.....|..:|:..|:.         |.|:             ||.::        |:|....|.
Yeast   254 NRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQ--------PSLNHFTDP 310

  Fly   230 NITTLYVGNLPEEITEPELRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQ 294
            |.||:::|.|...:||.|||..|..||.|..:.:...:.|.||||..|.:|| ||........|.
Yeast   311 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAE-AAIAGMQGFPIA 374

  Fly   295 GRKVSIKWAHSQAKQGTA----AKTDRRFDLAGIPPPSAKPN-DYFNLRQEQINVMPAGMKLHQL 354
            ..:|.:.|..| ||| ||    |.......:....|...:|| .|......:..|:|.    :.:
Yeast   375 NSRVRLSWGRS-AKQ-TALLQQAMLSNSLQVQQQQPGLQQPNYGYIPSSTCEAPVLPD----NNV 433

  Fly   355 PSNLVPASAYQMYGQPTYAAPYG------------NATSTALSSSGVNLDSISIPPPPGQ 402
            .|.::|......|..| ||...|            |||:|..:|...:..|:.:....||
Yeast   434 SSTMLPGCQILNYSNP-YANANGLGSNNFSFYSNNNATNTQATSLLADTSSMDLSGTGGQ 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14641NP_649440.3 ZnF_C3H1 159..185 CDD:214632
RRM 186..>309 CDD:223796 40/143 (28%)
RRM_RBM22 231..304 CDD:240670 26/72 (36%)
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023
RRM2_SECp43_like 162..241 CDD:409781
RRM3_NGR1_NAM8_like 312..383 CDD:409782 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.