DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14641 and MRN1

DIOPT Version :9

Sequence 1:NP_649440.3 Gene:CG14641 / 40529 FlyBaseID:FBgn0037220 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_015140.1 Gene:MRN1 / 855917 SGDID:S000006105 Length:612 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:45/203 - (22%)
Similarity:79/203 - (38%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SFWVKGECKRGEECPYRHDKPNEPDDPLCEQNIKDRYYGRNDPVAEKIMKRAASLPTLEPP---- 226
            :|.:..|........|.:::.:....|..::|..    ..:|.::..||..|.::.....|    
Yeast   126 NFEIDNEVVHNNNRYYEYERSSNEVSPFDDENPN----VLSDGMSPTIMATATAVTNANAPLPVN 186

  Fly   227 ----EDRNIT-----TLYVGNLPEEITEPELRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAEL 282
                ...|.|     |:|:||:|..::..||.|. .:.|.:..:.::|.:.||||.:...:||.|
Yeast   187 AQANNPLNFTSAPSRTVYLGNVPPNLSVKELLDH-VRSGVVEDVKIIPEKMCAFVSFIDESAALL 250

  Fly   283 -AAERTFNKLVIQGRKVSIKWAHSQAKQGTAAKTDRRFDLAGIPPPSAKPNDYF----------N 336
             .::....:|.|..|.:.|.|       |...:.| ....|.|....|..|.|.          :
Yeast   251 FHSDAILKRLNIGDRDIKIGW-------GKPTRID-PIVAARISTDGATRNVYIGRMTIEGEESH 307

  Fly   337 LRQEQINV 344
            |.:||:.|
Yeast   308 LSEEQLRV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14641NP_649440.3 ZnF_C3H1 159..185 CDD:214632 3/18 (17%)
RRM 186..>309 CDD:223796 31/136 (23%)
RRM_RBM22 231..304 CDD:240670 23/78 (29%)
MRN1NP_015140.1 RRM1_MRN1 200..273 CDD:240964 22/80 (28%)
RRM2_MRN1 289..372 CDD:409943 7/27 (26%)
RRM3_MRN1 430..503 CDD:240965
RRM_SF 519..606 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14089
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.