DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14641 and NAB6

DIOPT Version :9

Sequence 1:NP_649440.3 Gene:CG14641 / 40529 FlyBaseID:FBgn0037220 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_013589.1 Gene:NAB6 / 854922 SGDID:S000004585 Length:1134 Species:Saccharomyces cerevisiae


Alignment Length:337 Identity:63/337 - (18%)
Similarity:110/337 - (32%) Gaps:108/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EICQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVAD---------NMPQSDVNKEYYIQNIDAQ 124
            ||.....:|:.|    .||..| |.|..||......:         .:.::..|...:.|:|.:.
Yeast   523 EIDMLATKLQGV----ELDGTY-LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSP 582

  Fly   125 LQ------DGDGTEAAGAVGRSLAANEMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECPYRH 183
            |.      ..|..::.||:    ...::::..:..:|..:.|:..:                   
Yeast   583 LPLNEHMFMNDSNQSNGAI----IPQQLIATPSPVSPNLQMNQRVL------------------- 624

  Fly   184 DKPNEPDDPLCEQNIKDRYYGRNDPVAEKIMKRAASLPTLEPPEDRNITTLYVGNL-----PEEI 243
              || |.....|||..         |:.|:.....|        |....|:|:||:     .|:|
Yeast   625 --PN-PITQSLEQNFN---------VSAKVASSMGS--------DIGNRTIYIGNINPRSKAEDI 669

  Fly   244 TEPELRDQFYQFGEIRSIALVPRQQCAFVQYTKR-NAAELAAERTFNKLVIQGRKVSIKWAHSQA 307
            .      ...:.|.::||..:|.::..||.:.:. :|.:..|....:.:|:.|..:.:.|.|...
Yeast   670 C------NVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSG 728

  Fly   308 KQGTAAKTDRRFDLAGIPPP---------SAKPNDYFNLRQ----EQINVMPAGMKLHQ---LPS 356
                             |.|         .|..|.|.:|.:    |:....|...|||:   ||.
Yeast   729 -----------------PLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPD 776

  Fly   357 NLVPASAYQMYG 368
            .......:..||
Yeast   777 AEQLREDFSTYG 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14641NP_649440.3 ZnF_C3H1 159..185 CDD:214632 1/25 (4%)
RRM 186..>309 CDD:223796 28/128 (22%)
RRM_RBM22 231..304 CDD:240670 17/78 (22%)
NAB6NP_013589.1 RRM 60..104 CDD:287364
Nab6_mRNP_bdg 199..560 CDD:287529 11/41 (27%)
RRM3_MRN1 652..725 CDD:240965 17/78 (22%)
RRM_SF 741..860 CDD:302621 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14089
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.