DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14641 and AT5G04210

DIOPT Version :9

Sequence 1:NP_649440.3 Gene:CG14641 / 40529 FlyBaseID:FBgn0037220 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_196041.1 Gene:AT5G04210 / 830300 AraportID:AT5G04210 Length:193 Species:Arabidopsis thaliana


Alignment Length:154 Identity:52/154 - (33%)
Similarity:80/154 - (51%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ICSFWVKG-ECKRGEECPYRHDKPNEPDDPLCEQNIKDRYYGRN---DPVAEKIMKRAASLPTLE 224
            ||..:..| :|.||..|.|||:.....|   |        :||:   :|...:::.||.:...|:
plant    16 ICPLFDAGRQCTRGTMCLYRHEINRGLD---C--------HGRSGLENPFVLEVLARACNTGPLK 69

  Fly   225 PPEDRNITTLYVGNL-PEEITEPELRDQFYQFGEIRSIALVPRQ---QCAFVQYTKRNAAELAAE 285
            ||||::|.|||:..| ...:.|.::||.|..:|||.||.:.|.:   .|||:.||.|.|||.|..
plant    70 PPEDQSIKTLYIRRLINSSVLEQDIRDHFCPYGEIESIVIFPHRGGGTCAFLTYTTRLAAEKAML 134

  Fly   286 RTFNKLVIQGRKVSIKWAHSQAKQ 309
            ...:...|:|::|.:.|..::..|
plant   135 ELSSWTDIKGQRVKLLWGPTEKWQ 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14641NP_649440.3 ZnF_C3H1 159..185 CDD:214632 10/21 (48%)
RRM 186..>309 CDD:223796 41/129 (32%)
RRM_RBM22 231..304 CDD:240670 29/76 (38%)
AT5G04210NP_196041.1 RRM <64..>148 CDD:223796 32/83 (39%)
RRM_SF 76..152 CDD:302621 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0153
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003246
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.