DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14641 and nrd1

DIOPT Version :10

Sequence 1:NP_649440.3 Gene:CG14641 / 40529 FlyBaseID:FBgn0037220 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_592982.1 Gene:nrd1 / 2541755 PomBaseID:SPAC2F7.11 Length:529 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:31/123 - (25%)
Similarity:56/123 - (45%) Gaps:7/123 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RNITTLYVGNLPEEITEPELRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVI 293
            |||   |:||..:.:|...|::.|.:||||..:.....:.||||.:|...:|..|.:|...|...
pombe   414 RNI---YIGNADDSLTIERLKEDFEEFGEIEYVNFFREKNCAFVNFTSLASAINAIDRIKQKKGY 475

  Fly   294 QGRKVSIKWAHSQAKQGTAAKTDRRFDLAGIPPPSAKPNDYFNLRQEQINVMPAGMKL 351
            :..::|    :.:.:.|...:|:.:.|:..:....:.|.|....:|.....||....:
pombe   476 ENYRIS----YGKDRCGNPPRTNSKSDVLSVSSDMSMPVDLVVPQQGISGFMPTNSNI 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14641NP_649440.3 ZnF_C3H1 159..185 CDD:214632
RRM_RBM22 231..304 CDD:409671 21/72 (29%)
PABP-1234 <234..>377 CDD:130689 28/118 (24%)
nrd1NP_592982.1 RRM 37..66 CDD:402136
RRM1_MRN1 114..187 CDD:240964
RRM2_MRN1 203..280 CDD:409943
RRM3_MRN1 322..395 CDD:240965
RRM4_MRN1 411..489 CDD:409942 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.