DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and TEP1

DIOPT Version :9

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:NP_014271.3 Gene:TEP1 / 855595 SGDID:S000005072 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:66/330 - (20%)
Similarity:110/330 - (33%) Gaps:87/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 LSAAIPSSYNGHGSLLSSLRGGAGTLLKNIKDTSTKVMQTMQQSLARNDLD-------ISHITSR 420
            ||..:..:.|..|     ||.....:|.|:...|..| .|..:.|.||.||       :.|....
Yeast    27 LSLPMKKTKNDIG-----LRLDISYILVNLIVCSYPV-NTYPKLLYRNSLDDLILFLTVYHGKGN 85

  Fly   421 ILVMPCPSDGFESTYKTNNIEDVRLSLESR-FVPQKL--SIYNFGQRTEPRLPPPVRTV---EAG 479
            ..:.....:..:|.||.|::..:....||: |..|:|  ::.|.|:.....:....||:   |..
Yeast    86 FRIFNFRGEKEDSDYKDNDLIGIAAKFESKDFEIQELRSTLINDGKIPISPIDLETRTLVEEETN 150

  Fly   480 SV----YGCPQAHAPNLQGLFTVSADMYNFLNADPKSVVIVQTGDSGGCTAATVICALLMYADLL 540
            :|    .|......|..:.|..:...:.|:|:.....|.::......|.:....:..|:.|   |
Yeast   151 NVICERIGWLDHFPPPFELLEEIVDGIENYLSVSKNRVAVLHCRMGKGRSGMITVAYLMKY---L 212

  Fly   541 REP-EDAVQVFAVKRHTINLR-----PSEFRYLYYFG---------------------------- 571
            :.| .:|..:|...|....:.     ||:.|||.|..                            
Yeast   213 QCPLGEARLIFMQARFKYGMTNGVTIPSQLRYLRYHEFFITHEKAAQEGISNEAVKFKFKFRLAK 277

  Fly   572 -DILRPTPL-----------LPHYKNTTLVSLSCQPVPRMTKARDGCRIYMEVY---CNGNLLLS 621
             ..|||:.|           :.||.:.....|:.:.|            |.::.   |.||:...
Yeast   278 MTFLRPSSLITSESAIVTTKIQHYNDDRNALLTRKVV------------YSDIMAHECGGNMTFI 330

  Fly   622 TLQDY 626
            ..:||
Yeast   331 FGRDY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393 10/49 (20%)
DnaJ <1110..1150 CDD:197617
TEP1NP_014271.3 PTP_PTEN-like 43..251 CDD:350347 46/211 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.