DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and AUL1

DIOPT Version :9

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:NP_001320612.1 Gene:AUL1 / 843868 AraportID:AT1G75310 Length:1451 Species:Arabidopsis thaliana


Alignment Length:223 Identity:59/223 - (26%)
Similarity:94/223 - (42%) Gaps:39/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   941 LSGKSPVNTSPQ---PTQFSSPTHKPSPSSQPQATFMHTPPTPQTLPSTSSIRTPTQPQAVPAQS 1002
            |||||..:.:..   ...|||...:.. ||..|.|     ....:.||.||.:|   .:..|.|.
plant  1259 LSGKSAASQAKSYGGSKSFSSSGERRG-SSSSQGT-----ENKSSGPSNSSNQT---AKGEPIQR 1314

  Fly  1003 RPDYSRLHFDSQKAAQQPGTGGSKNSDIFADILGQQGYSFGSKMNQCPRSINEMRKEDLFKDMDP 1067
            ....|..|              .:.||..|:.|.::      |:........:..:..|.:.:| 
plant  1315 CKARSERH--------------QRTSDRAAEALAEK------KLRDLKTQKEQTERNRLAEALD- 1358

  Fly  1068 KKVRIMEWTDGKKNNIRALLCSMHTVLWDNAKWQRCEMSTMVTPTEVKKAYRRACLAVHPDKHN- 1131
              ..:..|:.||:||:|||:.::..:|...:.|:...::.:|:...|:||||:|.|.|||||.. 
plant  1359 --ADVKRWSSGKENNLRALISTLQYILGAESGWKPIPLTDLVSSASVRKAYRKATLYVHPDKLQQ 1421

  Fly  1132 ---GTENEEIAKLIFMELNNAWTDFEND 1156
               .|:.:.|.:.:|..|..||..|..|
plant  1422 RGASTQQKYICEKVFDLLKEAWNKFGAD 1449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393
DnaJ <1110..1150 CDD:197617 16/43 (37%)
AUL1NP_001320612.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23172
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.