DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and AUL1

DIOPT Version :10

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:NP_001320612.1 Gene:AUL1 / 843868 AraportID:AT1G75310 Length:1451 Species:Arabidopsis thaliana


Alignment Length:53 Identity:13/53 - (24%)
Similarity:22/53 - (41%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKPVSVFG--EQMHTIHCVELENGTVKKQCLRFREYVYVNYFS-----ISDTY 46
            ::.::.||  ..|.....||...||.:...:.|......|:|.     |:|:|
plant    29 LEKLAYFGLVPNMILFLTVEYGMGTAEAANILFLWSAATNFFPLVGAFIADSY 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 Protein Kinases, catalytic domain 49..326 CDD:473864
PTP_auxilin-like 404..573 CDD:350361
PTEN_C2 581..711 CDD:463081
PHA03247 <698..1037 CDD:223021
Herpes_BLLF1 <882..>999 CDD:282904
DnaJ <1110..1150 CDD:99751
AUL1NP_001320612.1 PTZ00121 <804..1357 CDD:173412
tolA <1143..>1269 CDD:236545
DnaJ <1399..1444 CDD:99751
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.