DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and AT4G36520

DIOPT Version :9

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:NP_195370.5 Gene:AT4G36520 / 829804 AraportID:AT4G36520 Length:1422 Species:Arabidopsis thaliana


Alignment Length:212 Identity:57/212 - (26%)
Similarity:91/212 - (42%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   985 STSSIR-TPTQPQAVPAQSRPDYSRLHFDSQKAAQQPGTGGSKNSDIFADILGQQGYSFG----- 1043
            :||..| ...:..|..|:.|.:.|    .|.|.:|..|..|.:.....:|...|...|||     
plant  1213 ATSEARDRAAEKAAFEARERMERS----VSDKQSQSSGFFGERMEISLSDKQFQNSVSFGASRYQ 1273

  Fly  1044 --------------SKMNQCPRSINEMRKEDLFKDM--------DPKKVRIME--------WTDG 1078
                          |::.:..|:.:.:.|....|:|        ..:::||.|        |:.|
plant  1274 DSHGTEGESPQRYTSRLERHQRTADRVAKALAEKNMRDLVAQREQAERIRIAETLDTEVKRWSSG 1338

  Fly  1079 KKNNIRALLCSMHTVLWDNAKWQRCEMSTMVTPTEVKKAYRRACLAVHPDK--HNGT--ENEEIA 1139
            |:.||||||.::..:|...:.||...::.::|...||:|||:|.|.|||||  ..|.  ..:.|.
plant  1339 KEGNIRALLSTLQYILGPESGWQPLPLTEVITSAAVKRAYRKATLCVHPDKLQQRGANIHQKYIC 1403

  Fly  1140 KLIFMELNNAWTDFEND 1156
            :.:|..|..||..|.::
plant  1404 EKVFDLLKEAWNRFNSE 1420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393
DnaJ <1110..1150 CDD:197617 17/43 (40%)
AT4G36520NP_195370.5 GBP_C <613..727 CDD:303769
GBP_C <687..863 CDD:303769
coiled coil 698..709 CDD:293879
coiled coil 716..727 CDD:293879
coiled coil 834..845 CDD:293879
coiled coil 854..863 CDD:293879
DnaJ 1360..1422 CDD:197617 22/61 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23172
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.