DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and Pten

DIOPT Version :9

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:NP_113794.1 Gene:Pten / 50557 RGDID:61995 Length:403 Species:Rattus norvegicus


Alignment Length:427 Identity:98/427 - (22%)
Similarity:163/427 - (38%) Gaps:109/427 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 MQQSLARN---------DLDISHITSRILVMPCPSDGFESTYKTNNIEDVRLSLESRFVPQKLSI 458
            :::.::||         |||:::|...|:.|..|::..|..|: |||:||...|:|:. .....|
  Rat     5 IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYR-NNIDDVVRFLDSKH-KNHYKI 67

  Fly   459 YNF-GQRTEPRLPPPVRTVEAGSVYGCPQAHAPNLQGLFTVSADMYNFLNADPKSVVIVQTGDSG 522
            ||. .:|.........|..:    |.....:.|.|:.:.....|:..:|:.|...|..:......
  Rat    68 YNLCAERHYDTAKFNCRVAQ----YPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGK 128

  Fly   523 GCTAATVICALLMYADLLREPEDAVQVFAVKRH------TINLRPSEFRYLYYFGDIL------R 575
            |.| ..:|||.|::.....:.::|:..:...|.      ||   ||:.||:||:..:|      |
  Rat   129 GRT-GVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI---PSQRRYVYYYSYLLKNHLDYR 189

  Fly   576 PTPLLPHYKNTTLVSLSCQPVPRMTKARDGCRIYMEVYCNGNLLLSTLQDYEKMRLYQAGPG--- 637
            |..||.|       .:..:.:|..:...          ||...::..|    |:::|.:..|   
  Rat   190 PVALLFH-------KMMFETIPMFSGGT----------CNPQFVVCQL----KVKIYSSNSGPTR 233

  Fly   638 ---KIV---LPINLTACGDVTVVLFHARKGMVRPQGLKICQFQFNTGFIPEPE------------ 684
               |::   .|..|..|||:.|..||.:..|::..  |:..|..||.|||.||            
  Rat   234 REDKLMYFEFPQPLPVCGDIKVEFFHKQNKMLKKD--KMFHFWVNTFFIPGPEETSEKVENGSLC 296

  Fly   685 -------------------TLITFTNQDLDDLPDPE---QVTPRFCVSLSLAVTDSESPPSHKPP 727
                               .::|.|..|||.....:   ..:|.|.|.|....|..|        
  Rat   297 DQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEE-------- 353

  Fly   728 WMPAKPKRSPAALFSSDLEYAEMLDNFVTKPSTRSSP 764
              |:.|:.|.:...:.|:...|. |::....:|.|.|
  Rat   354 --PSNPEASSSTSVTPDVSDNEP-DHYRYSDTTDSDP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393 35/172 (20%)
DnaJ <1110..1150 CDD:197617
PtenNP_113794.1 PTP_PTEN 24..181 CDD:350359 42/166 (25%)
PTEN_C2 188..349 CDD:402161 40/183 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.