DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and Tpte2

DIOPT Version :9

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:XP_038950660.1 Gene:Tpte2 / 364629 RGDID:1305825 Length:674 Species:Rattus norvegicus


Alignment Length:325 Identity:75/325 - (23%)
Similarity:139/325 - (42%) Gaps:45/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 DLDISHITSRILVMPCPSDGFESTYKTNNIEDVRLSLESRFVPQKLSIYNF-GQRT-EP-RLPPP 472
            |||::::|.||:.|..||.|.||.|: |.|::|...|:::. |....:||. .:|: :| |....
  Rat   360 DLDLTYVTERIIAMSFPSSGRESFYR-NPIKEVVRFLDTKH-PNHYQVYNLCSERSYDPKRFHYR 422

  Fly   473 VRTVEAGSVYGCPQAHAPNLQGLFTVSADMYNFLNADPKSVVIVQTGDSGGCTAATVICALLMYA 537
            ||.:.      ....:.|.|:.:...|.::.:::..||::||.:......|.| .|::||.|:.:
  Rat   423 VRRIM------IDDHNVPTLEEMLLFSKEVNDWMAQDPENVVAIHCKGGKGRT-GTMVCACLIAS 480

  Fly   538 DLLREPEDAVQVFAVKR------------HTINLRPSEFRYLYYFGDILRPTPL-LPHYKNTTLV 589
            :::...:.::..|..:|            .|    ||:.||:.||..:.....| ||..|...:.
  Rat   481 EIVLNAKASLYFFGERRTDKSNSSKFQGVET----PSQNRYVKYFEKLKTSYQLTLPPKKVLVIK 541

  Fly   590 SLSCQPVPRMTKARDGCRIYMEVYCNGNLLLSTLQDYEKMRLYQAGPGKIVLPI-NLTACGDVTV 653
            ..:...:..:.|. :|..:.:::......:.|.......|..:.....|:::.: |..|..|...
  Rat   542 RFTVYSIHGVGKG-NGSDLEIQIMMWQETIFSCFNSKNCMIFHDVETDKVIINVFNCPALYDDVK 605

  Fly   654 VLFHARKGMVRPQGLKICQ--FQFNTGFIPEPETLITFTNQDLDDLPDPEQVT-----PRFCVSL 711
            |.|....   .|:....|.  |.|:|.||  ....:.....:||:  ..:|.|     |:|.|.:
  Rat   606 VKFLCPN---LPKYYDDCPFFFWFHTSFI--RNNRLYLPRSELDN--THKQKTWKIYGPKFAVEV 663

  Fly   712  711
              Rat   664  663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393 26/137 (19%)
DnaJ <1110..1150 CDD:197617
Tpte2XP_038950660.1 PTP_VSP_TPTE 348..524 CDD:350360 47/176 (27%)
PTEN_C2 533..667 CDD:402161 26/139 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.