DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aux and Tpte

DIOPT Version :9

Sequence 1:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster
Sequence 2:NP_954866.2 Gene:Tpte / 234129 MGIID:2446460 Length:664 Species:Mus musculus


Alignment Length:321 Identity:75/321 - (23%)
Similarity:135/321 - (42%) Gaps:60/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 DLDISHITSRILVMPCPSDGFESTYKTNNIEDVRLSLESRFVPQKLSIYNFGQRTEPRLPPP--- 472
            |||::::|.||:.|..||.|.||.|: |.|::|...|:::. |....:||.  .:|....|.   
Mouse   356 DLDLTYVTERIIAMSFPSSGRESFYR-NPIKEVVRFLDTKH-PNHYQVYNL--CSERAYDPKHFH 416

  Fly   473 --VRTVEAGSVYGCPQAHAPNLQGLFTVSADMYNFLNADPKSVVIVQTGDSGGCTAATVICALLM 535
              ||.:.      ....:.|.|:.:...|.::.|::..||::||.:......|.| .|::||.|:
Mouse   417 YRVRRIM------IDDHNVPTLEEMLLFSKEVNNWMAQDPENVVAIHCKGGKGRT-GTMVCACLI 474

  Fly   536 YADLLREPEDAVQVFAVKR----HTINLR----PSEFRYLYYFGDI-LRPTPLLPHYKNTTLVSL 591
            .::::...::::..|..:|    ::...:    ||:.||:.||..: :.....||..|...:..|
Mouse   475 ASEIVLNAKESLYFFGERRTDKSNSSKFQGIETPSQNRYVKYFEKLKINYQLTLPPKKVLVIKRL 539

  Fly   592 SCQPVPRMTKARDGCRIYMEV---------YCNG-NLLLSTLQDYEKMRLYQAGPGKIVLPINLT 646
            ....:..:.|. ||..:.:::         :||. |.::  ..|.|..|..          ||:.
Mouse   540 VVYSIHGVGKG-DGSDLEVQIIMWQETVFSFCNSRNCMI--FHDPETDRAI----------INVF 591

  Fly   647 AC----GDVTVVLFHARKGMVRPQGLKICQ--FQFNTGFIPEPETLITFTNQDLDDLPDPE 701
            .|    .||.|......    .|:....|.  |.|:|.||  ....:.....:||:...|:
Mouse   592 HCPALYDDVKVKFLSPN----LPKYYDDCPFFFWFHTSFI--KNNRLYLPRNELDNTHKPK 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393 28/137 (20%)
DnaJ <1110..1150 CDD:197617
TpteNP_954866.2 PTPc_motif 413..>478 CDD:214649 16/71 (23%)
PTEN_C2 529..663 CDD:287393 28/137 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.